PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1007.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Whirly
Protein Properties Length: 290aa    MW: 32309.9 Da    PI: 10.0483
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1007.4genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly2194.2e-681042421139
                        Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpa 81 
                                   s+yk+kaal+v++++p+f+aldsg++kl+++G++ll++a+a+++r+ydW++kq+f+ls+te+++lv+l+++esceffhdp+
  evm.model.supercontig_1007.4 104 SIYKGKAALTVEPRAPEFVALDSGAFKLSKEGFVLLQFAPAAGVRQYDWSRKQVFSLSVTEIGTLVSLGTRESCEFFHDPF 184
                                   7******************************************************************************** PP

                        Whirly  82 akgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                                   +++s+eGkvrk+lkvePlpdGsG+f+nlsv+n+l++ +e++++P+++ae++vl s+++
  evm.model.supercontig_1007.4 185 KGKSEEGKVRKVLKVEPLPDGSGHFFNLSVQNKLLNMDENIYIPITRAEYTVLVSAFN 242
                                   *****************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.105.2E-6993245IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.65E-6497255IPR009044ssDNA-binding transcriptional regulator
PfamPF085369.1E-61105239IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MLQQQLQFLS SPPVAVKFKA LNPKFCHTSS FSYTNSIDTS HGFSSNISTI SFKENVTKKL  60
LVKCRHSDYF EQKKFSDSSS FSSQSPAGAT TAGGLPPRFF VGHSIYKGKA ALTVEPRAPE  120
FVALDSGAFK LSKEGFVLLQ FAPAAGVRQY DWSRKQVFSL SVTEIGTLVS LGTRESCEFF  180
HDPFKGKSEE GKVRKVLKVE PLPDGSGHFF NLSVQNKLLN MDENIYIPIT RAEYTVLVSA  240
FNYAIFIFML VWRLLVSQSH VRERVKGPSS VIPKQARSIA YNENHLRES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4koo_D2e-98922522161Single-stranded DNA-binding protein WHY1, chl
4koo_C2e-98922522161Single-stranded DNA-binding protein WHY1, chl
4koo_B2e-98922522161Single-stranded DNA-binding protein WHY1, chl
4koo_A2e-98922522161Single-stranded DNA-binding protein WHY1, chl
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006483225.11e-110PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ9M9S31e-111WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A067H5511e-110A0A067H551_CITSI; Uncharacterized protein
STRINGAT1G14410.11e-108(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50232752
Representative plantOGRP23161635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.21e-104ssDNA-binding transcriptional regulator